PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02628.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 310aa    MW: 34416.9 Da    PI: 8.1927
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02628.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-54211481128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              +ppGfrFhPtdeel+++yL kkv ++++++  +i++vd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkat
  Rsa1.0_02628.1_g00006.1  21 MPPGFRFHPTDEELITYYLLKKVLDSNFSC-AAISQVDLNKSEPWELPEKAKMGEKEWYFFTLRDRKYPTGLRTNRATEAGYWKAT 105
                              79****************************.88***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+e++s+ +++l g+kktLvfykgrapkgek+ Wvmheyrl
  Rsa1.0_02628.1_g00006.1 106 GKDREIKSSkTNSLLGMKKTLVFYKGRAPKGEKSCWVMHEYRL 148
                              *******9856677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6115173IPR003441NAC domain
PROSITE profilePS5100557.40621173IPR003441NAC domain
PfamPF023651.4E-2822148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010014Biological Processmeristem initiation
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048467Biological Processgynoecium development
GO:0051782Biological Processnegative regulation of cell division
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDMDVFNGWE RSSRFEDETA MPPGFRFHPT DEELITYYLL KKVLDSNFSC AAISQVDLNK  60
SEPWELPEKA KMGEKEWYFF TLRDRKYPTG LRTNRATEAG YWKATGKDRE IKSSKTNSLL  120
GMKKTLVFYK GRAPKGEKSC WVMHEYRLDG KFSYHYITSS AKDEWVLSKV CLKSSVVSRE  180
TKLNISSGGV NCSSSASSLI APMIDAAFAK EHVSCFSNTS AAHAAADASF PPTYLPAPSP  240
SLPRQPRFFG DDVAFGQFMD VGASSGQFSI DAAFLPNLPS LPPTVFTPPS HQSFGMYGGS  300
ALSSSWPFAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-501817514167NAC domain-containing protein 19
4dul_A6e-501817514167NAC domain-containing protein 19
1ut7_B6e-501817514167NO APICAL MERISTEM PROTEIN
1ut7_A6e-501817514167NO APICAL MERISTEM PROTEIN
1ut4_B6e-501817514167NO APICAL MERISTEM PROTEIN
1ut4_A6e-501817514167NO APICAL MERISTEM PROTEIN
3swp_D7e-501817517170NAC domain-containing protein 19
3swp_C7e-501817517170NAC domain-containing protein 19
3swp_B7e-501817517170NAC domain-containing protein 19
3swp_A7e-501817517170NAC domain-containing protein 19
3swm_D7e-501817517170NAC domain-containing protein 19
3swm_C7e-501817517170NAC domain-containing protein 19
3swm_B7e-501817517170NAC domain-containing protein 19
3swm_A7e-501817517170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00357DAPTransfer from AT3G15170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667550.0KC966755.1 Brassica napus NAC transcription factor 54-2 (NAC54-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626711.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FRV41e-149NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A0D3BBF70.0A0A0D3BBF7_BRAOL; Uncharacterized protein
STRINGBra001586.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134811528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15170.11e-133NAC family protein